PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim08g076010.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family G2-like
Protein Properties Length: 362aa    MW: 40859.8 Da    PI: 6.9213
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim08g076010.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.81e-32105159155
             G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                         kprlrWt +LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQkYRl
  Sopim08g076010.0.1 105 KPRLRWTADLHDRFVDAVTKLGGPDKATPKSVLRLMGLKGLTLYHLKSHLQKYRL 159
                         79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.455102162IPR017930Myb domain
Gene3DG3DSA:1.10.10.609.6E-32102160IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-24105160IPR006447Myb domain, plants
SuperFamilySSF466894.48E-16105162IPR009057Homeodomain-like
PfamPF002491.2E-8107158IPR001005SANT/Myb domain
PfamPF143796.6E-24205251IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MTITHLLVSS IWEDVARDCT NILFSSFFAE YSTLSPTCHF SIRSSRAHIS QNSRHRLPLV  60
FSDLWKSFED FEEFGSGGFM DRMYNGGGDM GYGYENGVVM TRDPKPRLRW TADLHDRFVD  120
AVTKLGGPDK ATPKSVLRLM GLKGLTLYHL KSHLQKYRLG QQTKKQNAAE QNRENIGESF  180
RQFSLHSSGP SITSSSMDGM QGEAPISEAL RRQIDVQKRL HEQLEVQQKL QMRIEAQGKY  240
LQAILDKAQK SLSTDMNSAS AVDETRAQLT DFNIALSNLM DYVHGHNEDE TSAGKRIQDD  300
TNKDLQRSTY LTEGEQKKIM NIKLEESSVS FDLNSRSSYD FIGMNSAALE AKQFSNGRLE  360
I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00544DAPTransfer from AT5G45580Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0092620.0AP009262.1 Solanum lycopersicum genomic DNA, chromosome 8, clone: C08HBa0006A17, complete sequence.
GenBankHG9755200.0HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004245962.10.0PREDICTED: myb family transcription factor APL isoform X2
TrEMBLK4CMW80.0K4CMW8_SOLLC; Uncharacterized protein
STRINGSolyc08g076010.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA44162139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.14e-84G2-like family protein